No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IHC-P,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00051079-B02 |
Product name: | NDUFA13 MaxPab mouse polyclonal antibody (B02) |
Product description: | Mouse polyclonal antibody raised against a full-length human NDUFA13 protein. |
Gene id: | 51079 |
Gene name: | NDUFA13 |
Gene alias: | B16.6|CDA016|CGI-39|GRIM-19|GRIM19 |
Gene description: | NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13 |
Genbank accession: | BC009189.2 |
Immunogen: | NDUFA13 (AAH09189.1, 1 a.a. ~ 144 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT |
Protein accession: | AAH09189.1 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | NDUFA13 MaxPab polyclonal antibody. Western Blot analysis of NDUFA13 expression in human liver. |
Applications: | WB-Ti,IHC-P,IF,WB-Tr |
Shipping condition: | Dry Ice |