No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Rat |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00051062-M10 |
| Product name: | SPG3A monoclonal antibody (M10), clone 1B11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SPG3A. |
| Clone: | 1B11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51062 |
| Gene name: | ATL1 |
| Gene alias: | AD-FSP|FSP1|GBP3|SPG3|SPG3A|atlastin1 |
| Gene description: | atlastin GTPase 1 |
| Genbank accession: | NM_015915 |
| Immunogen: | SPG3A (NP_056999, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAKNRRDRNSWGGFSEKTYEWSSEEEEPVKKAGPVQVLIVKDDHSFELDETALNRILLSEAVRDKEVVAVSVAGAFRKGKSFLMDFMLRYMYNQESVDWV |
| Protein accession: | NP_056999 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: | ![]() |
| Application image note: | SPG3A monoclonal antibody (M10), clone 1B11. Western Blot analysis of SPG3A expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |