Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of LAP3 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re,WB-Tr |
More info about LAP3 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00051056-A01 |
| Product name: | LAP3 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant LAP3. |
| Gene id: | 51056 |
| Gene name: | LAP3 |
| Gene alias: | LAP|LAPEP|PEPS |
| Gene description: | leucine aminopeptidase 3 |
| Genbank accession: | NM_015907 |
| Immunogen: | LAP3 (NP_056991, 420 a.a. ~ 519 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | EASIETGDRVWRMPLFEHYTRQVVDCQLADVNNIGKYRSAGACTAAAFLKEFVTHPKWAHLDIAGVMTNKDEVPYLRKGMTGRPTRTLIEFLLRFSQDNA |
| Protein accession: | NP_056991 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | LAP3 polyclonal antibody (A01), Lot # FHC4060725QCS1 Western Blot analysis of LAP3 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Cytosolic Aminopeptidases Influence MHC Class I-Mediated Antigen Presentation in an Allele-Dependent Manner.Kim E, Kwak H, Ahn K. J Immunol. 2009 Dec 1;183(11):7379-87. Epub 2009 Nov 16. |