Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GMNN monoclonal antibody (M02), clone 1B10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Clonality | Monoclonal |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr |
More info about GMNN monoclonal antibody (M02), clone 1B10
| Reference: | H00051053-M02 |
| Product name: | GMNN monoclonal antibody (M02), clone 1B10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GMNN. |
| Clone: | 1B10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51053 |
| Gene name: | GMNN |
| Gene alias: | Gem|RP3-369A17.3 |
| Gene description: | geminin, DNA replication inhibitor |
| Genbank accession: | BC005185 |
| Immunogen: | GMNN (AAH05185, 110 a.a. ~ 209 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | LYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMAELIERLNGEPLDNFESLDNQEFDSEEETVEDSLVEDSEIGTCAEGTVSSSTDAKPCI |
| Protein accession: | AAH05185 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Shipping condition: | Dry Ice |