| Brand: | Abnova |
| Reference: | H00051050-M02 |
| Product name: | PI15 monoclonal antibody (M02), clone 3B5 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PI15. |
| Clone: | 3B5 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51050 |
| Gene name: | PI15 |
| Gene alias: | CRISP8|DKFZp686F0366|P24TI|P25TI |
| Gene description: | peptidase inhibitor 15 |
| Genbank accession: | NM_015886 |
| Immunogen: | PI15 (NP_056970, 18 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | EASTVVLLNSTDSSPPTNNFTDIEAALKAQLDSADIPKARRKRYISQNDMIAILDYHNQVRGKVFPPAANMEYMVWDENLAKSAEAWAATCIWDHGPSYL |
| Protein accession: | NP_056970 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PI15 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml] |
| Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |