| Brand: | Abnova |
| Reference: | H00051043-M03 |
| Product name: | ZBTB7B monoclonal antibody (M03), clone 1D4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant ZBTB7B. |
| Clone: | 1D4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 51043 |
| Gene name: | ZBTB7B |
| Gene alias: | DKFZp686G01254|THPOK|ZBTB15|ZFP67|ZNF857B|c-Krox|hcKrox |
| Gene description: | zinc finger and BTB domain containing 7B |
| Genbank accession: | NM_015872 |
| Immunogen: | ZBTB7B (NP_056956.1, 433 a.a. ~ 537 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | HLCHRAFAKEDHLQRHLKGQNCLEVRTRRRRKDDAPPHYPPPSTAAAFPAGLDLSNGHLDTFRLSLARFWEQSAPTWAPVSTPGPPDDDEEEGAPTTPQAEGAME |
| Protein accession: | NP_056956.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged ZBTB7B is 0.03 ng/ml as a capture antibody. |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |