| Brand: | Abnova |
| Reference: | H00051027-M07 |
| Product name: | BOLA1 monoclonal antibody (M07), clone 2H3 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant BOLA1. |
| Clone: | 2H3 |
| Isotype: | IgG1 Kappa |
| Gene id: | 51027 |
| Gene name: | BOLA1 |
| Gene alias: | CGI-143|MGC75015|RP11-196G18.18 |
| Gene description: | bolA homolog 1 (E. coli) |
| Genbank accession: | NM_016074 |
| Immunogen: | BOLA1 (NP_057158, 38 a.a. ~ 137 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | TKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP |
| Protein accession: | NP_057158 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |