View larger

FIS1 monoclonal antibody (M09), clone 3C8

Reference:

Condition: New product

Data sheet of FIS1 monoclonal antibody (M09), clone 3C8

Brand:	Abnova
Reference:	H00051024-M09
Product name:	FIS1 monoclonal antibody (M09), clone 3C8
Product description:	Mouse monoclonal antibody raised against a partial recombinant FIS1.
Clone:	3C8
Isotype:	IgG2a Kappa
Gene id:	51024
Gene name:	FIS1
Gene alias:	CGI-135\|TTC11
Gene description:	fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae)
Genbank accession:	NM_016068
Immunogen:	FIS1 (NP_057152.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence:	MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRTRYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQT
Protein accession:	NP_057152.1
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody Reactive Against Recombinant Protein.
Quality control testing picture:
Quality control testing picture note:	Western Blot detection against Immunogen (36.74 KDa) .
Product type:	Primary antibodies
Host species:	Mouse
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Detection limit for recombinant GST tagged FIS1 is 0.1 ng/ml as a capture antibody.
Applications:	S-ELISA,ELISA,WB-Re
Shipping condition:	Dry Ice