No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00051024-M02 |
Product name: | FIS1 monoclonal antibody (M02), clone 3G6 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant FIS1. |
Clone: | 3G6 |
Isotype: | IgG2b Kappa |
Gene id: | 51024 |
Gene name: | FIS1 |
Gene alias: | CGI-135|TTC11 |
Gene description: | fission 1 (mitochondrial outer membrane) homolog (S. cerevisiae) |
Genbank accession: | BC003540 |
Immunogen: | FIS1 (AAH03540.1, 1 a.a. ~ 152 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS |
Protein accession: | AAH03540.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (42.46 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | FIS1 monoclonal antibody (M02), clone 3G6. Western Blot analysis of FIS1 expression in MCF-7 ( Cat # L046V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |