View larger

EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)

Reference:

Condition: New product

Data sheet of EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)

Brand:	Abnova
Reference:	H00051010-D01P
Product name:	EXOSC3 purified MaxPab rabbit polyclonal antibody (D01P)
Product description:	Rabbit polyclonal antibody raised against a full-length human EXOSC3 protein.
Gene id:	51010
Gene name:	EXOSC3
Gene alias:	CGI-102\|MGC15120\|MGC723\|RP11-3J10.8\|RRP40\|Rrp40p\|bA3J10.7\|hRrp40p\|p10
Gene description:	exosome component 3
Genbank accession:	NM_016042.2
Immunogen:	EXOSC3 (NP_057126.2, 1 a.a. ~ 275 a.a) full-length human protein.
Immunogen sequence/protein sequence:	MAEPASVAAESLAGSRARAARTVLGQVVLPGEELLLPEQEDAEGPGGAVERPLSLNARACSRVRVVCGPGLRRCGDRLLVTKCGRLRHKEPGSGSGGGVYWVDSQQKRYVPVKGDHVIGIVTAKSGDIFKVDVGGSEPASLSYLSFEGATKRNRPNVQVGDLIYGQFVVANKDMEPEMVCIDSCGRANGMGVIGQDGLLFKVTLGLIRKLLAPDCEIIQEVGKLYPLEIVFGMNGRIWVKAKTIQQTLILANILEACEHMTSDQRKQIFSRLAES
Protein accession:	NP_057126.2
Storage buffer:	In 1x PBS, pH 7.4
Storage instruction:	Store at -20Â°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing:	Antibody reactive against mammalian transfected lysate.
Product type:	Primary antibodies
Host species:	Rabbit
Antigen species / target species:	Human
Reactivity:	Human
Application image:
Application image note:	Western Blot analysis of EXOSC3 expression in transfected 293T cell line (H00051010-T02) by EXOSC3 MaxPab polyclonal antibody. Lane 1: EXOSC3 transfected lysate(29.60 KDa). Lane 2: Non-transfected lysate.
Applications:	WB-Ti,WB-Tr
Shipping condition:	Dry Ice