| Brand: | Abnova |
| Reference: | H00050846-M05 |
| Product name: | DHH monoclonal antibody (M05), clone 1B12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DHH. |
| Clone: | 1B12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 50846 |
| Gene name: | DHH |
| Gene alias: | HHG-3|MGC35145 |
| Gene description: | desert hedgehog homolog (Drosophila) |
| Genbank accession: | NM_021044 |
| Immunogen: | DHH (NP_066382, 210 a.a. ~ 310 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | SGERKGLRELHRGDWVLAADASGRVVPTPVLLFLDRDLQRRASFVAVETEWPPRKLLLTPWHLVFAARGPAPAPGDFAPVFARRLRAGDSVLAPGGDALRP* |
| Protein accession: | NP_066382 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | DHH monoclonal antibody (M05), clone 1B12. Western Blot analysis of DHH expression in human colon. |
| Applications: | WB-Ti,ELISA |
| Shipping condition: | Dry Ice |