No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00050839-M10 |
| Product name: | TAS2R10 monoclonal antibody (M10), clone 4C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant TAS2R10. |
| Clone: | 4C10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 50839 |
| Gene name: | TAS2R10 |
| Gene alias: | MGC126811|MGC126813|T2R10|TRB2 |
| Gene description: | taste receptor, type 2, member 10 |
| Genbank accession: | CN836251 |
| Immunogen: | TAS2R10 (AAH63585, 1 a.a. ~ 124 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MLRVVEGIFIFVVVSESVFGVLGNGFIGLVNCIDCAKNKLSTIGFILTGLAISRIFLIWIIITDGFIQIFSPNIYASGNLIEYISYFWVIGNQSSMWFATSLSIFYFLKIANFSNYIFLWLKSG |
| Protein accession: | AAH63585 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |