NSDHL monoclonal antibody (M01), clone 6E3 View larger

NSDHL monoclonal antibody (M01), clone 6E3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NSDHL monoclonal antibody (M01), clone 6E3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about NSDHL monoclonal antibody (M01), clone 6E3

Brand: Abnova
Reference: H00050814-M01
Product name: NSDHL monoclonal antibody (M01), clone 6E3
Product description: Mouse monoclonal antibody raised against a partial recombinant NSDHL.
Clone: 6E3
Isotype: IgG2a Kappa
Gene id: 50814
Gene name: NSDHL
Gene alias: H105E3|SDR31E1|XAP104
Gene description: NAD(P) dependent steroid dehydrogenase-like
Genbank accession: NM_015922
Immunogen: NSDHL (NP_057006, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MEPAVSEPMRDQVARTHLTEDTPKVNADIEKVNQNQAKRCTVIGGSGFLGQHMVEQLLARGYAVNVFDIQQGFDNPQVRFFLGDLCSRQDLYPALKGVNTVFHCASPPPS
Protein accession: NP_057006
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00050814-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00050814-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged NSDHL is approximately 0.1ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NSDHL monoclonal antibody (M01), clone 6E3 now

Add to cart