Brand: | Abnova |
Reference: | H00050808-D01 |
Product name: | AK3 MaxPab rabbit polyclonal antibody (D01) |
Product description: | Rabbit polyclonal antibody raised against a full-length human AK3 protein. |
Gene id: | 50808 |
Gene name: | AK3 |
Gene alias: | AK3L1|AK6|AKL3L|AKL3L1|FIX |
Gene description: | adenylate kinase 3 |
Genbank accession: | NM_016282.2 |
Immunogen: | AK3 (NP_057366.2, 1 a.a. ~ 227 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP |
Protein accession: | NP_057366.2 |
Storage buffer: | No additive |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Rabbit |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | AK3 MaxPab rabbit polyclonal antibody. Western Blot analysis of AK3 expression in HeLa. |
Applications: | WB-Ce,WB-Tr,IP |
Shipping condition: | Dry Ice |