| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human,Mouse |
| Host species | Mouse |
| Applications | WB-Ce,WB-Tr |
| Brand: | Abnova |
| Reference: | H00050808-B01 |
| Product name: | AK3 MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human AK3 protein. |
| Gene id: | 50808 |
| Gene name: | AK3 |
| Gene alias: | AK3L1|AK6|AKL3L|AKL3L1|FIX |
| Gene description: | adenylate kinase 3 |
| Genbank accession: | NM_016282.2 |
| Immunogen: | AK3 (NP_057366.2, 1 a.a. ~ 227 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGASARLLRAVIMGAPGSGKGTVSSRITTHFELKHLSSGDLLRDNMLRGTEIGVLAKAFIDQGKLIPDDVMTRLALHELKNLTQYSWLLDGFPRTLPQAEALDRAYQIDTVINLNVPFEVIKQRLTARWIHPASGRVYNIEFNPPKTVGIDDLTGEPLIQREDDKPETVIKRLKAYEDQTKPVLEYYQKKGVLETFSGTETNKIWPYVYAFLQTKVPQRSQKASVTP |
| Protein accession: | NP_057366.2 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Mouse |
| Application image: | ![]() |
| Application image note: | Western Blot analysis of AK3 expression in transfected 293T cell line (H00050808-T01) by AK3 MaxPab polyclonal antibody. Lane 1: AK3 transfected lysate(24.97 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |