| Brand: | Abnova |
| Reference: | H00050807-M01 |
| Product name: | DDEF1 monoclonal antibody (M01), clone 2G7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant DDEF1. |
| Clone: | 2G7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 50807 |
| Gene name: | ASAP1 |
| Gene alias: | AMAP1|CENTB4|DDEF1|KIAA1249|PAG2|PAP|ZG14P |
| Gene description: | ArfGAP with SH3 domain, ankyrin repeat and PH domain 1 |
| Genbank accession: | NM_018482 |
| Immunogen: | DDEF1 (NP_060952, 1030 a.a. ~ 1129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | VQSRDAIQKQASEDSNDLTPTLPETPVPLPRKINTGKNKVRRVKTIYDCQADNDDELTFIEGEVIIVTGEEDQEWWIGHIEGQPERKGVFPVSFVHILSD |
| Protein accession: | NP_060952 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human,Rat |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to DDEF1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |