No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | ELISA |
Brand: | Abnova |
Reference: | H00050650-A01 |
Product name: | ARHGEF3 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ARHGEF3. |
Gene id: | 50650 |
Gene name: | ARHGEF3 |
Gene alias: | DKFZp434F2429|FLJ98126|GEF3|MGC118905|STA3|XPLN |
Gene description: | Rho guanine nucleotide exchange factor (GEF) 3 |
Genbank accession: | NM_019555 |
Immunogen: | ARHGEF3 (NP_062455, 33 a.a. ~ 142 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | EPSNKRVKPLSRVTSLANLIPPVKATPLKRFSQTLQRSISFRSESRPDILAPRPWSRNAAPSSTKRRDSKLWSETFDVCVNQMLTSKEIKRQEAIFELSQGEEDLIEDLK |
Protein accession: | NP_062455 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |
Publications: | ARHGEF3 controls HDACi-induced differentiation via RhoA-dependent pathways in acute myeloid leukemias.D'Amato L, Dell'Aversana C, Conte M, Ciotta A, Scisciola L, Carissimo A, Nebbioso A, Altucci L. Epigenetics. 2014 Dec 12:0. |