No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00050628-A01 |
Product name: | GEMIN4 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GEMIN4. |
Gene id: | 50628 |
Gene name: | GEMIN4 |
Gene alias: | DKFZp434B131|DKFZp434D174|HC56|HCAP1|HHRF-1|p97 |
Gene description: | gem (nuclear organelle) associated protein 4 |
Genbank accession: | NM_015721 |
Immunogen: | GEMIN4 (NP_056536, 959 a.a. ~ 1057 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS |
Protein accession: | NP_056536 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | GEMIN4 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of GEMIN4 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |