Product successfully added to your shopping cart
Quantity
Total
There are 2 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 840,00 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 840,00 €
Data sheet of GEMIN4 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about GEMIN4 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00050628-A01 |
| Product name: | GEMIN4 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant GEMIN4. |
| Gene id: | 50628 |
| Gene name: | GEMIN4 |
| Gene alias: | DKFZp434B131|DKFZp434D174|HC56|HCAP1|HHRF-1|p97 |
| Gene description: | gem (nuclear organelle) associated protein 4 |
| Genbank accession: | NM_015721 |
| Immunogen: | GEMIN4 (NP_056536, 959 a.a. ~ 1057 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | AAGPWVQGPEQDLTQEALFVYTQVFCHALHIMAMLHPEVCEPLYVLALETLTCYETLSKTNPSVSSLLQRAHEQRFLKSIAEGIGPEERRQTLLQKMSS |
| Protein accession: | NP_056536 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | GEMIN4 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of GEMIN4 expression in MES-SA/Dx5 ( Cat # L021V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |