| Brand: | Abnova |
| Reference: | H00050604-M01 |
| Product name: | IL20 monoclonal antibody (M01), clone 2H8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL20. |
| Clone: | 2H8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 50604 |
| Gene name: | IL20 |
| Gene alias: | IL-20|IL10D|MGC96907|ZCYTO10 |
| Gene description: | interleukin 20 |
| Genbank accession: | NM_018724 |
| Immunogen: | IL20 (NP_061194, 67 a.a. ~ 176 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | RTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
| Protein accession: | NP_061194 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | IL20 monoclonal antibody (M01), clone 2H8 Western Blot analysis of IL20 expression in K-562 ( Cat # L009V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |