No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Tr |
Brand: | Abnova |
Reference: | H00050604-B02P |
Product name: | IL20 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human IL20 protein. |
Gene id: | 50604 |
Gene name: | IL20 |
Gene alias: | IL-20|IL10D|MGC96907|ZCYTO10 |
Gene description: | interleukin 20 |
Genbank accession: | NM_018724.3 |
Immunogen: | IL20 (NP_061194.2, 1 a.a. ~ 176 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MKASSLAFSLLSAAFYLLWTPSTGLKTLNLGSCVIATNLQEIRNGFSEIRGSVQAKDGNIDIRILRRTESLQDTKPANRCCLLRHLLRLYLDRVFKNYQTPDHYTLRKISSLANSFLTIKKDLRLCHAHMTCHCGEEAMKKYSQILSHFEKLEPQAAVVKALGELDILLQWMEETE |
Protein accession: | NP_061194.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of IL20 expression in transfected 293T cell line (H00050604-T02) by IL20 MaxPab polyclonal antibody. Lane 1: IL20 transfected lysate(19.36 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Tr |
Shipping condition: | Dry Ice |