No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00030851-M01 |
| Product name: | TAX1BP3 monoclonal antibody (M01), clone 4A10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TAX1BP3. |
| Clone: | 4A10 |
| Isotype: | IgG1 kappa |
| Gene id: | 30851 |
| Gene name: | TAX1BP3 |
| Gene alias: | TIP-1 |
| Gene description: | Tax1 (human T-cell leukemia virus type I) binding protein 3 |
| Genbank accession: | BC023980 |
| Immunogen: | TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
| Protein accession: | AAH23980 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (39.38 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged TAX1BP3 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The HPV16 E6 binding protein Tip-1 interacts with ARHGEF16, which activates Cdc42.Oliver AW, He X, Borthwick K, Donne AJ, Hampson L, Hampson IN. Br J Cancer. 2010 Dec 7. [Epub ahead of print] |