No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | S-ELISA,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00030851-M01 |
Product name: | TAX1BP3 monoclonal antibody (M01), clone 4A10 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant TAX1BP3. |
Clone: | 4A10 |
Isotype: | IgG1 kappa |
Gene id: | 30851 |
Gene name: | TAX1BP3 |
Gene alias: | TIP-1 |
Gene description: | Tax1 (human T-cell leukemia virus type I) binding protein 3 |
Genbank accession: | BC023980 |
Immunogen: | TAX1BP3 (AAH23980, 1 a.a. ~ 124 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSYIPGQPVTAVVQRVEIHKLRQGENLILGFSIGGGIDQDPSQNPFSEDKTDKGIYVTRVSEGGPAEIAGLQIGDKIMQVNGWDMTMVTHDQARKRLTKRSEEVVRLLVTRQSLQKAVQQSMLS |
Protein accession: | AAH23980 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (39.38 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Detection limit for recombinant GST tagged TAX1BP3 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | The HPV16 E6 binding protein Tip-1 interacts with ARHGEF16, which activates Cdc42.Oliver AW, He X, Borthwick K, Donne AJ, Hampson L, Hampson IN. Br J Cancer. 2010 Dec 7. [Epub ahead of print] |