No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00030849-M04 |
Product name: | PIK3R4 monoclonal antibody (M04), clone 1H7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3R4. |
Clone: | 1H7 |
Isotype: | IgG2a Kappa |
Gene id: | 30849 |
Gene name: | PIK3R4 |
Gene alias: | MGC102700|VPS15|p150 |
Gene description: | phosphoinositide-3-kinase, regulatory subunit 4 |
Genbank accession: | NM_014602 |
Immunogen: | PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK |
Protein accession: | NP_055417 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | PIK3R4 monoclonal antibody (M04), clone 1H7. Western Blot analysis of PIK3R4 expression in PC-12 ( Cat # L012V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |