No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Brand: | Abnova |
| Reference: | H00030849-M03 |
| Product name: | PIK3R4 monoclonal antibody (M03), clone 1G12 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PIK3R4. |
| Clone: | 1G12 |
| Isotype: | IgG2a Kappa |
| Gene id: | 30849 |
| Gene name: | PIK3R4 |
| Gene alias: | MGC102700|VPS15|p150 |
| Gene description: | phosphoinositide-3-kinase, regulatory subunit 4 |
| Genbank accession: | NM_014602 |
| Immunogen: | PIK3R4 (NP_055417, 1259 a.a. ~ 1358 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | AGSDMKIRFWDLAYPERSYVVAGSTSSPSVSYYRKIIEGTEVVQEIQNKQKVGPSDDTPRRGPESLPVGHHDIITDVATFQTTQGFIVTASRDGIVKVWK |
| Protein accession: | NP_055417 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | PIK3R4 monoclonal antibody (M03), clone 1G12 Western Blot analysis of PIK3R4 expression in HeLa ( Cat # L013V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Class III PI3K regulates organismal glucose homeostasis by providing negative feedback on hepatic insulin signalling.Nemazanyy I, Montagnac G, Russell RC, Morzyglod L, Burnol AF, Guan KL, Pende M, Panasyuk G. Nat Commun. 2015 Sep 21;6:8283. |