| Brand: | Abnova |
| Reference: | H00030845-M01 |
| Product name: | EHD3 monoclonal antibody (M01), clone 4B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant EHD3. |
| Clone: | 4B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 30845 |
| Gene name: | EHD3 |
| Gene alias: | PAST3 |
| Gene description: | EH-domain containing 3 |
| Genbank accession: | NM_014600 |
| Immunogen: | EHD3 (NP_055415, 357 a.a. ~ 406 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPI |
| Protein accession: | NP_055415 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (31.24 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to EHD3 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | The HIV-1 protein Vpr impairs phagosome maturation by controlling microtubule-dependent trafficking.Dumas A, Le-Bury G, Marie-Anais F, Herit F, Mazzolini J, Guilbert T, Bourdoncle P, Russell DG, Benichou S, Zahraoui A, Niedergang F. J Cell Biol. 2015 Oct 26;211(2):359-72. |