Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of NT5C purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Tr |
More info about NT5C purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00030833-D01P |
| Product name: | NT5C purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human NT5C protein. |
| Gene id: | 30833 |
| Gene name: | NT5C |
| Gene alias: | DNT|DNT1|P5N2|PN-I|PN-II|UMPH2|cdN|dNT-1 |
| Gene description: | 5', 3'-nucleotidase, cytosolic |
| Genbank accession: | BC008183.1 |
| Immunogen: | NT5C (AAH08183.1, 1 a.a. ~ 117 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MARSVRVLVDMDGVLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIPGALDAVREMNDLPDPLLKYHHCVGEKVWLPRPYSARGAA |
| Protein accession: | AAH08183.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of NT5C expression in transfected 293T cell line (H00030833-T01) by NT5C MaxPab polyclonal antibody. Lane 1: NT5C transfected lysate(13.30 KDa). Lane 2: Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |