No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00030812-M01 |
Product name: | SOX8 monoclonal antibody (M01), clone 8G7 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SOX8. |
Clone: | 8G7 |
Isotype: | IgG2a Kappa |
Gene id: | 30812 |
Gene name: | SOX8 |
Gene alias: | MGC24837 |
Gene description: | SRY (sex determining region Y)-box 8 |
Genbank accession: | NM_014587 |
Immunogen: | SOX8 (NP_055402, 102 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VKRPMNAFMVWAQAARRKLADQYPHLHNAELSKTLGKLWRLLSESEKRPFVEEAERLRVQHKKDHPDYKYQPRRRKSAKAGHSDSDSGAELGPHPGGGAVYKAEAGLGD |
Protein accession: | NP_055402 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.73 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Immunofluorescence of monoclonal antibody to SOX8 on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,ELISA,WB-Re |
Shipping condition: | Dry Ice |