No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00030062-M16 |
| Product name: | RAX monoclonal antibody (M16), clone 1A10 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant RAX. |
| Clone: | 1A10 |
| Isotype: | IgG2a Kappa |
| Gene id: | 30062 |
| Gene name: | RAX |
| Gene alias: | MCOP3|RX |
| Gene description: | retina and anterior neural fold homeobox |
| Genbank accession: | NM_013435 |
| Immunogen: | RAX (NP_038463, 253 a.a. ~ 346 a.a) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GATALQSLPGFGPPAQSLPASYTPPPPPPPFLNSPPLGPGLQPLAPPPPSYPCGPGFGDKFPLDEADPRNSSIAALRLKAKEHIQAIGKPWQAL* |
| Protein accession: | NP_038463 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.34 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |