No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00030011-M01 |
| Product name: | SH3KBP1 monoclonal antibody (M01), clone 1F11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SH3KBP1. |
| Clone: | 1F11 |
| Isotype: | IgG2a Kappa |
| Gene id: | 30011 |
| Gene name: | SH3KBP1 |
| Gene alias: | CIN85|GIG10|MIG18 |
| Gene description: | SH3-domain kinase binding protein 1 |
| Genbank accession: | NM_031892 |
| Immunogen: | SH3KBP1 (NP_114098.1, 224 a.a. ~ 308 a.a) partial recombinant protein with GST-pstS1 tag. |
| Immunogen sequence/protein sequence: | IKLRPRSIEVENDFLPVEKTIGKKLPATTATPDSSKTEMDSRTKSKDYCKVIFPYEAQNDDELTIKEGDIVTLINKDCIDVGWWE |
| Protein accession: | NP_114098.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.29 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | SH3KBP1 monoclonal antibody (M01), clone 1F11. Western Blot analysis of SH3KBP1 expression in IMR-32. |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |