No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00030001-A01 |
Product name: | ERO1L polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ERO1L. |
Gene id: | 30001 |
Gene name: | ERO1L |
Gene alias: | ERO1-alpha |
Gene description: | ERO1-like (S. cerevisiae) |
Genbank accession: | NM_014584 |
Immunogen: | ERO1L (NP_055399, 90 a.a. ~ 178 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | DISQCGRRDCAVKPCQSDEVPDGIKSASYKYSEEANNLIEECEQAERLGAVDESLSEETQKAVLQWTKHDDSSDNFCEADDIQSPEAEY |
Protein accession: | NP_055399 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | ERO1L polyclonal antibody (A01), Lot # FAK0060317QCS1 Western Blot analysis of ERO1L expression in A-431 ( Cat # L015V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |
Publications: | Adiponectin Secretion is Regulated by SIRT1 and the ER oxidoreductase Ero1-L alpha.Qiang L, Wang H, Farmer SR. Mol Cell Biol. 2007 Jul;27(13):4698-707. Epub 2007 Apr 23. |