No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Rat |
Host species | Mouse |
Applications | WB-Ce,ELISA,WB-Re |
Brand: | Abnova |
Reference: | H00030000-A01 |
Product name: | TNPO2 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant TNPO2. |
Gene id: | 30000 |
Gene name: | TNPO2 |
Gene alias: | FLJ12155|IPO3|KPNB2B|TRN2 |
Gene description: | transportin 2 |
Genbank accession: | NM_013433 |
Immunogen: | TNPO2 (NP_038461, 201 a.a. ~ 300 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | MDRAQALMDNIDTFIEHLFALAVDDDPEVRKNVCRALVMLLEVRIDRLIPHMHSIIQYMLQRTQDHDENVALEACEFWLTLAEQPICKEVLASHLVQLIP |
Protein accession: | NP_038461 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![]() |
Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Rat |
Application image: | ![]() |
Application image note: | TNPO2 polyclonal antibody (A01), Lot # 060619JCS1 Western Blot analysis of TNPO2 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |