No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00029997-M03 |
| Product name: | GLTSCR2 monoclonal antibody (M03), clone 5A8 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GLTSCR2. |
| Clone: | 5A8 |
| Isotype: | IgG1 Kappa |
| Gene id: | 29997 |
| Gene name: | GLTSCR2 |
| Gene alias: | PICT-1|PICT1 |
| Gene description: | glioma tumor suppressor candidate region gene 2 |
| Genbank accession: | NM_015710 |
| Immunogen: | GLTSCR2 (NP_056525, 402 a.a. ~ 478 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL |
| Protein accession: | NP_056525 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (34.21 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged GLTSCR2 is approximately 0.1ng/ml as a capture antibody. |
| Applications: | IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Quantitative Proteomic profiling identifies protein correlates to EGFR kinase inhibition.Kani K, Faca VM, Hughes LD, Zhang W, Fang Q, Shahbaba B, Luethy R, Erde J, Schmidt J, Pitteri SJ, Zhang Q, Katz JE, Gross ME, Plevritis SK, McIntosh MW, Jain A, Hanash S, Agus DB, Mallick P. Mol Cancer Ther. 2012 May;11(5):1071-81. |