Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | IF,WB-Tr |
Brand: | Abnova |
Reference: | H00029995-B01P |
Product name: | LMCD1 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human LMCD1 protein. |
Gene id: | 29995 |
Gene name: | LMCD1 |
Gene alias: | - |
Gene description: | LIM and cysteine-rich domains 1 |
Genbank accession: | NM_014583.2 |
Immunogen: | LMCD1 (NP_055398.1, 1 a.a. ~ 365 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MAKVAKDLNPGVKKMSLGQLQSARGVACLGCKGTCSGFEPHSWRKICKSCKCSQEDHCLTSDLEDDRKIGRLLMDSKYSTLTARVKGGDGIRIYKRNRMIMTNPIATGKDPTFDTITYEWAPPGVTQKLGLQYMELIPKEKQPVTGTEGAFYRRRQLMHQLPIYDQDPSRCRGLLENELKLMEEFVKQYKSEALGVGEVALPGQGGLPKEEGKQQEKPEGAETTAATTNGSLSDPSKEVEYVCELCKGAAPPDSPVVYSDRAGYNKQWHPTCFVCAKCSEPLVDLIYFWKDGAPWCGRHYCESLRPRCSGCDEIIFAEDYQRVEDLAWHRKHFVCEGCEQLLSGRAYIVTKGQLLCPTCSKSKRS |
Protein accession: | NP_055398.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of LMCD1 expression in transfected 293T cell line (H00029995-T01) by LMCD1 MaxPab polyclonal antibody. Lane 1: LMCD1 transfected lysate(40.15 KDa). Lane 2: Non-transfected lysate. |
Applications: | IF,WB-Tr |
Shipping condition: | Dry Ice |