No products
Prices are tax excluded
Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human |
Host species | Mouse |
Applications | WB-Ti,IF,WB-Tr |
Brand: | Abnova |
Reference: | H00029982-B02P |
Product name: | NRBF2 purified MaxPab mouse polyclonal antibody (B02P) |
Product description: | Mouse polyclonal antibody raised against a full-length human NRBF2 protein. |
Gene id: | 29982 |
Gene name: | NRBF2 |
Gene alias: | COPR1|COPR2|DKFZp564C1664|FLJ30395|NRBF-2 |
Gene description: | nuclear receptor binding factor 2 |
Genbank accession: | NM_030759 |
Immunogen: | NRBF2 (NP_110386.1, 1 a.a. ~ 287 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAQREERLKAQQNTDKDAAAHLQTSHKPSAEDAEGQSPLSQKYSPSTEKCLPEIQGIFDRDPDTLLYLLQQKSEPAEPCIGSKAPKDDKTIIEEQATKIADLKRHVEFLVAENERLRKENKQLKAEKARLLKGPIEKELDVDADFVETSELWSLPPHAETATASSTWQKFAANTGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGLMNN |
Protein accession: | NP_110386.1 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![]() |
Application image note: | Western Blot analysis of NRBF2 expression in transfected 293T cell line (H00029982-T02) by NRBF2 MaxPab polyclonal antibody. Lane 1: NRBF2 transfected lysate(31.57 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ti,IF,WB-Tr |
Shipping condition: | Dry Ice |