No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA |
| Brand: | Abnova |
| Reference: | H00029968-M01 |
| Product name: | PSAT1 monoclonal antibody (M01), clone 1C2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PSAT1. |
| Clone: | 1C2 |
| Isotype: | IgG2b Kappa |
| Gene id: | 29968 |
| Gene name: | PSAT1 |
| Gene alias: | EPIP|MGC1460|PSA|PSAT |
| Gene description: | phosphoserine aminotransferase 1 |
| Genbank accession: | NM_058179 |
| Immunogen: | PSAT1 (NP_478059, 262 a.a. ~ 370 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL |
| Protein accession: | NP_478059 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged PSAT1 is 0.03 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA |
| Shipping condition: | Dry Ice |