PSAT1 purified MaxPab mouse polyclonal antibody (B01P) View larger

PSAT1 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSAT1 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PSAT1 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00029968-B01P
Product name: PSAT1 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PSAT1 protein.
Gene id: 29968
Gene name: PSAT1
Gene alias: EPIP|MGC1460|PSA|PSAT
Gene description: phosphoserine aminotransferase 1
Genbank accession: NM_058179.2
Immunogen: PSAT1 (NP_478059.1, 1 a.a. ~ 370 a.a) full-length human protein.
Immunogen sequence/protein sequence: MDAPRQVVNFGPGPAKLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCGQFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
Protein accession: NP_478059.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029968-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PSAT1 expression in transfected 293T cell line (H00029968-T01) by PSAT1 MaxPab polyclonal antibody.

Lane 1: PSAT1 transfected lysate(40.7 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSAT1 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart