Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PSAT1 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,ELISA,WB-Re |
More info about PSAT1 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00029968-A01 |
| Product name: | PSAT1 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant PSAT1. |
| Gene id: | 29968 |
| Gene name: | PSAT1 |
| Gene alias: | EPIP|MGC1460|PSA|PSAT |
| Gene description: | phosphoserine aminotransferase 1 |
| Genbank accession: | NM_058179 |
| Immunogen: | PSAT1 (NP_478059, 262 a.a. ~ 370 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | GGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL |
| Protein accession: | NP_478059 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (38.1 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | PSAT1 polyclonal antibody (A01), Lot # 051214JCO1 Western Blot analysis of PSAT1 expression in IMR-32 ( Cat # L008V1 ). |
| Applications: | WB-Ce,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Glutamine-utilizing transaminases are a metabolic vulnerability of TAZ/YAP-activated cancer cells.Yang CS, Stampouloglou E, Kingston NM, Zhang L, Monti S, Varelas X. EMBO Rep. 2018 Apr 16. pii: e43577. |