| Brand: | Abnova |
| Reference: | H00029959-M02 |
| Product name: | NRBP1 monoclonal antibody (M02), clone 2B4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NRBP1. |
| Clone: | 2B4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29959 |
| Gene name: | NRBP1 |
| Gene alias: | BCON3|FLJ27109|FLJ35541|MADM|MUDPNP|NRBP |
| Gene description: | nuclear receptor binding protein 1 |
| Genbank accession: | BC001221 |
| Immunogen: | NRBP1 (AAH01221, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS |
| Protein accession: | AAH01221 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | NRBP1 monoclonal antibody (M02), clone 2B4 Western Blot analysis of NRBP1 expression in Jurkat ( Cat # L017V1 ). |
| Applications: | WB-Ce,S-ELISA,ELISA |
| Shipping condition: | Dry Ice |