No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Brand: | Abnova |
| Reference: | H00029959-M01 |
| Product name: | NRBP1 monoclonal antibody (M01), clone 4D2 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NRBP1. |
| Clone: | 4D2 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29959 |
| Gene name: | NRBP1 |
| Gene alias: | BCON3|FLJ27109|FLJ35541|MADM|MUDPNP|NRBP |
| Gene description: | nuclear receptor binding protein 1 |
| Genbank accession: | BC001221 |
| Immunogen: | NRBP1 (AAH01221, 436 a.a. ~ 535 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PAEVETRKVVLMQCNIESVEEGVKHHLTLLLKLEDKLNRHLSCDLMPNENIPELAAELVQLGFISEADQSRLTSLLEETLNKFNFARNSTLNSAAVTVSS |
| Protein accession: | AAH01221 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: | ![]() |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Immunofluorescence of monoclonal antibody to NRBP1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | WB-Ce,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Nuclear receptor binding protein 1 correlates with better prognosis and induces caspase-dependent intrinsic apoptosis through the JNK signalling pathway in colorectal cancer.Liao Y, Yang Z, Huang J, Chen H, Xiang J, Li S, Chen C, He X, Lin F, Yang Z, Wang J. Cell Death Dis. 2018 Mar 22;9(4):436. |