SNX12 purified MaxPab rabbit polyclonal antibody (D01P) View larger

SNX12 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX12 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ti,WB-Tr

More info about SNX12 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00029934-D01P
Product name: SNX12 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human SNX12 protein.
Gene id: 29934
Gene name: SNX12
Gene alias: MGC118982|MGC118983
Gene description: sorting nexin 12
Genbank accession: BC020559
Immunogen: SNX12 (N/A, 1 a.a. ~ 172 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA
Protein accession: N/A
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00029934-D01P-13-15-1.jpg
Application image note: Western Blot analysis of SNX12 expression in transfected 293T cell line (H00029934-T01) by SNX12 MaxPab polyclonal antibody.

Lane 1: SNX12 transfected lysate(18.92 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNX12 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart