Brand | Abnova |
Product type | Primary antibodies |
Reactivity | Human,Mouse,Rat |
Host species | Mouse |
Applications | WB-Ce,WB-Tr |
Brand: | Abnova |
Reference: | H00029934-B01P |
Product name: | SNX12 purified MaxPab mouse polyclonal antibody (B01P) |
Product description: | Mouse polyclonal antibody raised against a full-length human SNX12 protein. |
Gene id: | 29934 |
Gene name: | SNX12 |
Gene alias: | MGC118982|MGC118983 |
Gene description: | sorting nexin 12 |
Genbank accession: | BC020559 |
Immunogen: | SNX12 (AAH20559, 1 a.a. ~ 172 a.a) full-length human protein. |
Immunogen sequence/protein sequence: | MSDTAVADTRRLNSKPQDLTDAYGPPSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSLAVSCPGWSAVA |
Protein accession: | AAH20559 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody reactive against mammalian transfected lysate. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: | ![]() |
Application image note: | Western Blot analysis of SNX12 expression in transfected 293T cell line (H00029934-T01) by SNX12 MaxPab polyclonal antibody. Lane 1: SNX12 transfected lysate(18.92 KDa). Lane 2: Non-transfected lysate. |
Applications: | WB-Ce,WB-Tr |
Shipping condition: | Dry Ice |