TIMM22 purified MaxPab mouse polyclonal antibody (B01P) View larger

TIMM22 purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TIMM22 purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about TIMM22 purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00029928-B01P
Product name: TIMM22 purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human TIMM22 protein.
Gene id: 29928
Gene name: TIMM22
Gene alias: TEX4|TIM22
Gene description: translocase of inner mitochondrial membrane 22 homolog (yeast)
Genbank accession: NM_013337
Immunogen: TIMM22 (NP_037469, 1 a.a. ~ 194 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAAAAPNAGGSAPETAGSAEAPLQYSLLLQYLVGDKRQPRLLEPGSLGGIPSPAKSEEQKMIEKAMESCAFKAALACVGGFVLGGAFGVFTAGIDTNVGFDPKDPYRTPTAKEVLKDMGQRGMSYAKNFAIVGAMFSCTECLIESYRGTSDWKNSVISGCITGGAIGFRAGLKAGAIGCGGFAAFSAAIDYYLR
Protein accession: NP_037469
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029928-B01P-13-15-1.jpg
Application image note: Western Blot analysis of TIMM22 expression in transfected 293T cell line by TIMM22 MaxPab polyclonal antibody.

Lane 1: TIMM22 transfected lysate(21.34 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TIMM22 purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart