Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of GMPPA monoclonal antibody (M01), clone 2F1
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re,WB-Tr,IP |
More info about GMPPA monoclonal antibody (M01), clone 2F1
| Brand: | Abnova |
| Reference: | H00029926-M01 |
| Product name: | GMPPA monoclonal antibody (M01), clone 2F1 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant GMPPA. |
| Clone: | 2F1 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29926 |
| Gene name: | GMPPA |
| Gene alias: | - |
| Gene description: | GDP-mannose pyrophosphorylase A |
| Genbank accession: | NM_013335 |
| Immunogen: | GMPPA (NP_037467, 321 a.a. ~ 420 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | ESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL |
| Protein accession: | NP_037467 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of GMPPA expression in transfected 293T cell line by GMPPA monoclonal antibody (M01), clone 2F1. Lane 1: GMPPA transfected lysate(46.291 KDa). Lane 2: Non-transfected lysate. |
| Applications: | ELISA,WB-Re,WB-Tr,IP |
| Shipping condition: | Dry Ice |