No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
| Brand: | Abnova |
| Reference: | H00029922-M08A |
| Product name: | NME7 monoclonal antibody (M08A), clone 1A11 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant NME7. |
| Clone: | 1A11 |
| Isotype: | IgG1 Kappa |
| Gene id: | 29922 |
| Gene name: | NME7 |
| Gene alias: | FLJ37194|nm23-H7 |
| Gene description: | non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase) |
| Genbank accession: | NM_013330 |
| Immunogen: | NME7 (NP_004547, 277 a.a. ~ 374 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL |
| Protein accession: | NP_004547 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |