NME7 polyclonal antibody (A01) View larger

NME7 polyclonal antibody (A01)

New product

286,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NME7 polyclonal antibody (A01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about NME7 polyclonal antibody (A01)

Brand: Abnova
Reference: H00029922-A01
Product name: NME7 polyclonal antibody (A01)
Product description: Mouse polyclonal antibody raised against a partial recombinant NME7.
Gene id: 29922
Gene name: NME7
Gene alias: FLJ37194|nm23-H7
Gene description: non-metastatic cells 7, protein expressed in (nucleoside-diphosphate kinase)
Genbank accession: NM_013330
Immunogen: NME7 (NP_004547, 277 a.a. ~ 374 a.a) partial recombinant protein with GST tag.
Immunogen sequence/protein sequence: DRVNVEEFYEVYKGVVTEYHDMVTEMYSGPCVAMEIQQNNATKTFREFCGPADPEIARHLRPGTLRAIFGKTKIQNAVHCTDLPEDGLLEVQYFFKIL
Protein accession: NP_004547
Storage buffer: 50 % glycerol
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00029922-A01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.89 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NME7 polyclonal antibody (A01) now

Add to cart