SNX11 purified MaxPab mouse polyclonal antibody (B02P) View larger

SNX11 purified MaxPab mouse polyclonal antibody (B02P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SNX11 purified MaxPab mouse polyclonal antibody (B02P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about SNX11 purified MaxPab mouse polyclonal antibody (B02P)

Brand: Abnova
Reference: H00029916-B02P
Product name: SNX11 purified MaxPab mouse polyclonal antibody (B02P)
Product description: Mouse polyclonal antibody raised against a full-length human SNX11 protein.
Gene id: 29916
Gene name: SNX11
Gene alias: MGC111019
Gene description: sorting nexin 11
Genbank accession: NM_013323
Immunogen: SNX11 (NP_037455.2, 1 a.a. ~ 270 a.a) full-length human protein.
Immunogen sequence/protein sequence: MGFWCRMSENQEQEEVITVRVQDPRVQNEGSWNSYVDYKIFLHTNSKAFTAKTSCVRRRYREFVWLRKQLQRNAGLVPVPELPGKSTFFGTSDEFIEKRRQGLQHFLEKVLQSVVLLSDSQLHLFLQSQLSVPEIEACVQGRSTMTVSDAILRYAMSNCGWAQEERQSSSHLAKGDQPKSCCFLPRSGRRSSPSPPPSEEKDHLEVWAPVVDSEVPSLESPTLPPLSSPLCCDFGRPKEGTSTLQSVRRAVGGDHAVPLDPGQLETVLEK
Protein accession: NP_037455.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029916-B02P-13-15-1.jpg
Application image note: Western Blot analysis of SNX11 expression in transfected 293T cell line (H00029916-T02) by SNX11 MaxPab polyclonal antibody.

Lane 1: SNX11 transfected lysate(29.7 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SNX11 purified MaxPab mouse polyclonal antibody (B02P) now

Add to cart