| Reference: | H00029906-Q01 |
| Product name: | ST8SIA5 (Human) Recombinant Protein (Q01) |
| Product description: | Human ST8SIA5 partial ORF ( NP_037437, 33 a.a. - 132 a.a.) recombinant protein with GST-tag at N-terminal. |
| Gene id: | 29906 |
| Gene name: | ST8SIA5 |
| Gene alias: | MGC119670|MGC119671|SIAT8E|ST8SiaV |
| Gene description: | ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 5 |
| Genbank accession: | NM_013305 |
| Immunogen sequence/protein sequence: | QQILYGRNYIKRYFEFYEGPFEYNSTRCLELRHEILEVKVLSMVKQSELFDRWKSLQMCKWAMNISEANQFKSTLSRCCNAPAFLFTTQKNTPLGTKLKY |
| Protein accession: | NP_037437 |
| Preparation method: | in vitro wheat germ expression system |
| Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
| Note: | Best use within three months from the date of receipt of this protein. |
| Tag: | GST |
| Shipping condition: | Dry Ice |