No products
Prices are tax excluded
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Tr |
| Brand: | Abnova |
| Reference: | H00029895-M05 |
| Product name: | MYLPF monoclonal antibody (M05), clone 3H3 |
| Product description: | Mouse monoclonal antibody raised against a full-length recombinant MYLPF. |
| Clone: | 3H3 |
| Isotype: | IgG2a Kappa |
| Gene id: | 29895 |
| Gene name: | MYLPF |
| Gene alias: | DKFZp779C0757|MGC13450|MRLC2 |
| Gene description: | fast skeletal myosin light chain 2 |
| Genbank accession: | BC012571 |
| Immunogen: | MYLPF (AAH12571, 1 a.a. ~ 169 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MAPKRAKRRTVEGGSSSVFSMFDQTQIQEFKEAFTVIDQNRDGIIDKEDLRDTFAAMGRLNVKNEELDAMMKEASGPINFTVFLTMFGEKLKGADPEDVITGAFKVLDPEGKGTIKKKFLEELLTTQCDRFSQEEIKNMWAAFPPDVGGNVDYKNICYVITHGDAKDQE |
| Protein accession: | AAH12571 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: | ![]() |
| Application image note: | Detection limit for recombinant GST tagged MYLPF is 1 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Tr |
| Shipping condition: | Dry Ice |