PSMC3IP purified MaxPab mouse polyclonal antibody (B01P) View larger

PSMC3IP purified MaxPab mouse polyclonal antibody (B01P)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PSMC3IP purified MaxPab mouse polyclonal antibody (B01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Tr

More info about PSMC3IP purified MaxPab mouse polyclonal antibody (B01P)

Brand: Abnova
Reference: H00029893-B01P
Product name: PSMC3IP purified MaxPab mouse polyclonal antibody (B01P)
Product description: Mouse polyclonal antibody raised against a full-length human PSMC3IP protein.
Gene id: 29893
Gene name: PSMC3IP
Gene alias: GT198|HOP2|HUMGT198A|TBPIP
Gene description: PSMC3 interacting protein
Genbank accession: NM_016556
Immunogen: PSMC3IP (NP_057640.1, 1 a.a. ~ 217 a.a) full-length human protein.
Immunogen sequence/protein sequence: MSKGRAEAAAGAAGILLRYLQEQNRPYSSQDVFGNLQREHGLGKAVVVKTLEQLAQQGKIKEKMYGKQKIYFADQDQFDMVSDADLQVLDGKIVALTAKVQSLQQSCRYMEAELKELSSALTTPEMQKEIQELKKECAGYRERLKNIKAATNHVTPEEKEQVYRERQKYCKEWRKRKRMATELSDAILEGYPKSKKQFFEEVGIETDEDYNVTLPDP
Protein accession: NP_057640.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00029893-B01P-13-15-1.jpg
Application image note: Western Blot analysis of PSMC3IP expression in transfected 293T cell line (H00029893-T01) by PSMC3IP MaxPab polyclonal antibody.

Lane 1: TBPIP transfected lysate(23.87 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Tr
Shipping condition: Dry Ice

Reviews

Buy PSMC3IP purified MaxPab mouse polyclonal antibody (B01P) now

Add to cart