Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CNOT7 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about CNOT7 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00029883-A01 |
| Product name: | CNOT7 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant CNOT7. |
| Gene id: | 29883 |
| Gene name: | CNOT7 |
| Gene alias: | CAF1|hCAF-1 |
| Gene description: | CCR4-NOT transcription complex, subunit 7 |
| Genbank accession: | NM_013354 |
| Immunogen: | CNOT7 (NP_037486, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | MKKIRQVIRKYNYVAMDTEFPGVVARPIGEFRSNADYQYQLLRCNVDLLKIIQLGLTFMNEQGEYPPGTSTWQFNFKFNLTEDMYAQDSIELLTTSGIQF |
| Protein accession: | NP_037486 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.11 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | hCAF1/CNOT7 regulates interferon signalling by targeting STAT1.Chapat C, Kolytcheff C, Le Romancer M, Auboeuf D, De La Grange P, Chettab K, Sentis S, Corbo L EMBO J. 2013 Feb 12;32(5):688-700. doi: 10.1038/emboj.2013.11. Epub 2013 Feb 5. |