ALG5 purified MaxPab rabbit polyclonal antibody (D01P) View larger

ALG5 purified MaxPab rabbit polyclonal antibody (D01P)

New product

384,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of ALG5 purified MaxPab rabbit polyclonal antibody (D01P)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse
Host speciesRabbit
ApplicationsWB-Ce,WB-Ti,WB-Tr

More info about ALG5 purified MaxPab rabbit polyclonal antibody (D01P)

Brand: Abnova
Reference: H00029880-D01P
Product name: ALG5 purified MaxPab rabbit polyclonal antibody (D01P)
Product description: Rabbit polyclonal antibody raised against a full-length human ALG5 protein.
Gene id: 29880
Gene name: ALG5
Gene alias: RP11-421P11.2|bA421P11.2
Gene description: asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferase homolog (S. cerevisiae)
Genbank accession: NM_013338.3
Immunogen: ALG5 (NP_037470.1, 1 a.a. ~ 324 a.a) full-length human protein.
Immunogen sequence/protein sequence: MAPLLLQLAVLGAALAAAALVLISIVAFTTATKMPALHRHEEEKFFLNAKGQKETLPSIWDSPTKQLSVVVPSYNEEKRLPVMMDEALSYLEKRQKRDPAFTYEVIVVDDGSKDQTSKVAFKYCQKYGSDKVRVITLVKNRGKGGAIRMGIFSSRGEKILMADADGATKFPDVEKLEKGLNDLQPWPNQMAIACGSRAHLEKESIAQRSYFRTLLMYGFHFLVWFLCVKGIRDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN
Protein accession: NP_037470.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Product type: Primary antibodies
Host species: Rabbit
Antigen species / target species: Human
Reactivity: Human,Mouse
Application image: H00029880-D01P-13-15-1.jpg
Application image note: Western Blot analysis of ALG5 expression in transfected 293T cell line (H00029880-T01) by ALG5 MaxPab polyclonal antibody.

Lane 1: ALG5 transfected lysate(36.90 KDa).
Lane 2: Non-transfected lysate.
Applications: WB-Ce,WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy ALG5 purified MaxPab rabbit polyclonal antibody (D01P) now

Add to cart